NO02G04440, NO02G04440 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_005855897.1 (hypothetical protein NGA_2065400 [Nannochloropsis gaditana CCMP526] >EKU20460.1 hypothetical protein NGA_2065400 [Nannochloropsis gaditana CCMP526] >EWM30314.1 Complex 1 LYR protein [Nannochloropsis gaditana]) HSP 1 Score: 128.6 bits (322), Expect = 9.700e-27 Identity = 62/85 (72.94%), Postives = 76/85 (89.41%), Query Frame = 0 Query: 7 ATSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYHNKREI 92 A+ +AL LYRAIWRASR MPT RR++FVR KLR+E+EAAR ETD +K++FAL+YAALQLDT++IQAASL+KL CDP+YHNKREI Sbjct: 16 ASGGQALQLYRAIWRASRGMPTIRRKKFVRDKLREEFEAARHETDPSKVAFALEYAALQLDTVRIQAASLSKLVCDPMYHNKREI 100
BLAST of NO02G04440 vs. NCBI_GenBank
Match: OQR81731.1 (hypothetical protein THRCLA_23308 [Thraustotheca clavata]) HSP 1 Score: 72.8 bits (177), Expect = 6.300e-10 Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 0 Query: 10 TRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYH 87 ++AL YRAI+RA+ DMP+ R+QFVR +LR EYE R E + +I F L A QLDT+KIQ A + DP YH Sbjct: 4 SQALSYYRAIYRAAGDMPSKDRKQFVRQRLRVEYEKYRHEINPERIEFLLKVADTQLDTLKIQVAHFKNILSDPQYH 80
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_008863899.1 (hypothetical protein H310_02235 [Aphanomyces invadans] >ETW07806.1 hypothetical protein H310_02235 [Aphanomyces invadans]) HSP 1 Score: 68.6 bits (166), Expect = 1.200e-8 Identity = 37/87 (42.53%), Postives = 50/87 (57.47%), Query Frame = 0 Query: 2 PTTSSATSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYHNK 89 P+T AL LYR I+R + MPT R +FVR +LR EY+ R ETD +I F + A QLDT++IQ ++ P YHN+ Sbjct: 13 PSTQVTAMQIALSLYRKIYRTAGRMPTKDRTEFVRRRLRSEYDKYRHETDPERIEFLIKVADTQLDTLEIQVEHFDRVFSSPHYHNQ 99
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_009824523.1 (hypothetical protein H257_02538 [Aphanomyces astaci] >ETV86051.1 hypothetical protein H257_02538 [Aphanomyces astaci]) HSP 1 Score: 67.8 bits (164), Expect = 2.000e-8 Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 0 Query: 7 ATSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYHNK 89 +T +AL YR I+R + MPT R +FVR +LR EY+ R ET+ +I F + A QLDT++IQ A +++ P YHN+ Sbjct: 2 STRQQALSFYRKIYRTAGLMPTKDRTEFVRRRLRGEYDQYRHETNPARIEFLIKVADTQLDTLEIQVAHFSRVFSSPSYHNQ 83
BLAST of NO02G04440 vs. NCBI_GenBank
Match: GAQ78130.1 (hypothetical protein KFL_000080340 [Klebsormidium nitens]) HSP 1 Score: 67.4 bits (163), Expect = 2.600e-8 Identity = 35/70 (50.00%), Postives = 50/70 (71.43%), Query Frame = 0 Query: 10 TRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKL 80 +RAL LYRA +RA++ MPTA R+ ++R K R E+E R ETD ++I L +A LQLD ++IQA L++L Sbjct: 5 SRALALYRAFYRAAKSMPTANRRDYIRKKSRFEFEENRHETDPSRIRGLLQFADLQLDNVQIQAKHLSEL 74
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_008915091.1 (hypothetical protein PPTG_18671 [Phytophthora parasitica INRA-310] >ETI31081.1 hypothetical protein F443_21916 [Phytophthora parasitica P1569] >ETK71454.1 hypothetical protein L915_21312 [Phytophthora parasitica] >ETL24895.1 hypothetical protein L916_21182 [Phytophthora parasitica] >ETL78109.1 hypothetical protein L917_21037 [Phytophthora parasitica] >ETM31373.1 hypothetical protein L914_21052 [Phytophthora parasitica] >ETM99591.1 hypothetical protein PPTG_18671 [Phytophthora parasitica INRA-310] >ETO59783.1 hypothetical protein F444_21938 [Phytophthora parasitica P1976] >ETP00894.1 hypothetical protein F441_21799 [Phytophthora parasitica CJ01A1] >ETP29039.1 hypothetical protein F442_21777 [Phytophthora parasitica P10297]) HSP 1 Score: 67.0 bits (162), Expect = 3.500e-8 Identity = 36/79 (45.57%), Postives = 47/79 (59.49%), Query Frame = 0 Query: 8 TSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYH 87 T L LYRAI+RA+ MPT R +VR +LR EY+ R+E + +ISF L A QLDT+++QA L P YH Sbjct: 4 TRAEVLRLYRAIYRAAGKMPTRDRTNYVRRRLRHEYDQTREEINPERISFLLRLAETQLDTVEVQAQHLKSTFSSPDYH 82
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_024582031.1 (Complex 1 LYR protein [Plasmopara halstedii] >CEG45662.1 Complex 1 LYR protein [Plasmopara halstedii]) HSP 1 Score: 66.6 bits (161), Expect = 4.500e-8 Identity = 36/79 (45.57%), Postives = 48/79 (60.76%), Query Frame = 0 Query: 8 TSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYH 87 T AL LYRAI+RA+ MPT R +VR +LR EY+ R+E + +I F L A QL+T+++QA LT P YH Sbjct: 4 TQAEALRLYRAIYRAAGKMPTRDRTSYVRRRLRHEYDNMREEKNPERIRFFLRLAETQLETVQVQAEHLTSTFSSPDYH 82
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_002181439.1 (predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >EEC47362.1 predicted protein [Phaeodactylum tricornutum CCAP 1055/1]) HSP 1 Score: 64.7 bits (156), Expect = 1.700e-7 Identity = 35/80 (43.75%), Postives = 47/80 (58.75%), Query Frame = 0 Query: 7 ATSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYH 87 AT +AL LYR + R + MPT R++FV K R E+ + + TD +I F + A LDT+ IQA LT+L DP YH Sbjct: 5 ATRAKALSLYRQLLRGAEKMPTPNRRKFVVKKTRTEFRSNKSLTDPDEIQFCIRLADTNLDTVMIQAEHLTRLMKDPTYH 84
BLAST of NO02G04440 vs. NCBI_GenBank
Match: XP_012197157.1 (hypothetical protein SPRG_03177 [Saprolegnia parasitica CBS 223.65] >KDO31961.1 hypothetical protein SPRG_03177 [Saprolegnia parasitica CBS 223.65]) HSP 1 Score: 64.3 bits (155), Expect = 2.200e-7 Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 0 Query: 11 RALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYH 87 +AL YRAI+R + MP+ R +FVR +LR EYE R ET +++F L A QLDT+++Q ++ DP YH Sbjct: 3 QALSFYRAIYRTAGLMPSKDRTRFVRRRLRAEYEKYRHETSPERVAFLLQVADTQLDTLRVQVDHYNQVFSDPSYH 78
BLAST of NO02G04440 vs. NCBI_GenBank
Match: OQR92994.1 (hypothetical protein ACHHYP_03041 [Achlya hypogyna]) HSP 1 Score: 64.3 bits (155), Expect = 2.200e-7 Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 0 Query: 8 TSTRALHLYRAIWRASRDMPTARRQQFVRGKLRDEYEAARQETDATKISFALDYAALQLDTIKIQAASLTKLNCDPLYH 87 T ++A+ YR+I+RA+ +P+ R QFVR +LR EYE ET+ +ISF L A QLDT+ +Q ++ DP YH Sbjct: 2 TRSQAISFYRSIYRAAGLLPSKDRTQFVRRRLRSEYEKYLHETNPERISFLLQVADTQLDTLLVQVEHYNQVFSDPSYH 80 The following BLAST results are available for this feature:
BLAST of NO02G04440 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 11
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO02G04440 ID=NO02G04440|Name=NO02G04440|organism=Nannochloropsis oceanica|type=gene|length=276bpback to top protein sequence of NO02G04440.1 >NO02G04440.1-protein ID=NO02G04440.1-protein|Name=NO02G04440.1|organism=Nannochloropsis oceanica|type=polypeptide|length=92bpback to top Synonyms
Publications
|