NO01G02280, NO01G02280 (gene) Nannochloropsis oceanica

Overview
NameNO01G02280
Unique NameNO01G02280
Typegene
OrganismNannochloropsis oceanica (N. oceanica IMET1)
Sequence length1923
Alignment locationchr1:594696..596618 -

Link to JBrowse

Properties
Property NameValue
DescriptionRubisco expression protein
Mutants
The following records are associated with this feature:
TitleMethodAccession dateLast modified date
Rubisco activaseOverexpression2019-05-102019-05-10
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr1genomechr1:594696..596618 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
PXD0160542021-01-14
PXD0166992021-01-08
GSE1499042020-10-10
NoIMET1_WT_HS2020-09-29
PXD0100302020-03-16
GSE1396152020-03-11
PRJNA2413822020-03-11
BLASTP analysis of N. oceanica IMET1 genes2019-07-11
InterPro analysis for N. oceanica IMET1 genes2019-07-11
GO annotation for IMET1v2 genes2019-07-10
PXD0087212019-04-30
PRJNA1821802019-04-25
Gene prediction for N. oceanica IMET12017-10-24
Annotated Terms
The following terms have been associated with this gene:
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR000470CbxX_CfqX_mono
IPR000641CbxX_CfqX
Homology
BLAST of NO01G02280 vs. NCBI_GenBank
Match: EWM29164.1 (rubisco expression protein [Nannochloropsis gaditana] >EWM29165.1 rubisco expression protein [Nannochloropsis gaditana])

HSP 1 Score: 728.8 bits (1880), Expect = 9.700e-207
Identity = 369/419 (88.07%), Postives = 393/419 (93.79%), Query Frame = 0
Query:    1 MVVTAWKATLIGSCLFLASGFQVPAPCAPGRRLPVCMAEGEAPSKHGGLTYNKEKAMAGDINSGNYRKLSDAMIRAEKEAKRNEEXXXXXXMAEELARQARAKKVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLDLVRNASDDAILA 420
            MV T  KATL+G CLFLASGFQ+PAP A GR LP+ MAE E  SKHGGL Y++EKA++GD N+GN+RKLSDAM+RAEKEAKRNEE      MAEELARQARAKKVAKLN VMSTPKQ VGSADEFSWD GVQ ALD+L+ ELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCR+GHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLV+VGKLMFNNMEYKL+PDAEPALREYVTLRK+KLFFSNARSVRNAVDLARM+AANRVYE+ATAPGA+G+ITLD+LT++KKEDFDGLLDLVRNA + AILA
Sbjct:    1 MVTTMLKATLMGGCLFLASGFQMPAPRAMGRGLPIRMAE-EGGSKHGGLVYDREKALSGDANAGNFRKLSDAMVRAEKEAKRNEEERRQREMAEELARQARAKKVAKLNEVMSTPKQAVGSADEFSWDSGVQTALDRLDNELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRAGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVDVGKLMFNNMEYKLAPDAEPALREYVTLRKEKLFFSNARSVRNAVDLARMAAANRVYELATAPGASGLITLDELTQVKKEDFDGLLDLVRNAPEGAILA 418          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: AFP65258.1 (CbbX protein (nucleomorph) [Chroomonas mesostigmatica CCMP1168])

HSP 1 Score: 374.4 bits (960), Expect = 4.600e-100
Identity = 188/357 (52.66%), Postives = 256/357 (71.71%), Query Frame = 0
Query:   58 AGDINSGNYRKLSDAMIRAEKEAKRNEEXXXXXXMAEELARQARAKKVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLDLVRNASD 415
            +G+  S    KL DA+  A+ EA++  E       AEE  R A+  K+ +LN++    +   G+ +E+ +  GV+  L+KL+ +L+GL PVKSRVRE+A++LVVDK+R+++GLD  +   LHMCFTGAPGTGKTTVA RMG I + MGY RSGH+V+ATRD LVGQYVGHT PKTKEVIK+AMGG+L IDEAYYLYNA NDRDYG ESIEILL VME+   DL+V+ AGYKDRMD+FFS+IPGM SR+  HI+FP+ + ++L+ + K+M  ++EY+++ +AEP   EY+  R    +FSNAR+VRNAVD ARM AA R++  A  P + G+++  +L  ++K DF  + +L     D
Sbjct:   43 SGNNESSENNKLKDALNDADIEARKIREEADKRKQAEERKRMAKQLKIDRLNAIPEDAE--AGTVEEYMYKDGVKEILEKLDNDLVGLIPVKSRVREIAALLVVDKLRRNLGLDTGV-PSLHMCFTGAPGTGKTTVAMRMGQILQRMGYSRSGHLVVATRDDLVGQYVGHTAPKTKEVIKKAMGGVLLIDEAYYLYNASNDRDYGQESIEILLNVMEENREDLVVVLAGYKDRMDKFFSFIPGMSSRIGNHIEFPNYQAEELLSIAKVMCRDLEYEMAIEAEPVFFEYIKKRMKMPYFSNARTVRNAVDRARMRAAIRLFNKAFDPSSDGMVSKQELMTLEKNDFVSVEELTARGED 396          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: ABD51943.1 (CbbX protein, partial (nucleomorph) [Rhodomonas salina])

HSP 1 Score: 372.1 bits (954), Expect = 2.300e-99
Identity = 195/358 (54.47%), Postives = 265/358 (74.02%), Query Frame = 0
Query:   63 SGNYR--KLSDAMIRAEKEAKRNEEXXXXXXMAEELARQARAKKVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLDLVRNASDDAIL 419
            SGN +  ++SDA+  ++ EA++  EXXXXXX         +  K+ +LN++    +   G+ +EF +  GV+  L++L+ +L+GL PVKSRV+E+A++LVVDK+R+++GLD  +   LHMCFTGAPGTGKTTVA RMG I + MGY R GH+V+ATRD LVGQYVGHT PKTKEVIK+AMGG+L IDEAYYLYNA NDRDYG ESIEILL VME+   DL+V+ AGYKDRMD+FFS+IPGM SRV  HI+FP+ EP++L+++ K+M  ++EY+++PDAEP   EY+  R    FFSNAR+VRNAVD ARM AA R++  AT  G+ G+++  +L  ++K DF  + +L     D+AI+
Sbjct:   37 SGNQQNNEVSDALNESDIEARKIREXXXXXXXXXXXXXXXKQMKIDRLNAIPEDAE--AGTVEEFMYKDGVKDILEQLDNDLVGLVPVKSRVKEIAALLVVDKLRRNLGLDTGV-PSLHMCFTGAPGTGKTTVAMRMGQILQRMGYSRQGHLVVATRDDLVGQYVGHTAPKTKEVIKKAMGGVLLIDEAYYLYNASNDRDYGQESIEILLNVMEENREDLVVVLAGYKDRMDKFFSFIPGMSSRVGNHIEFPNYEPEELLQIAKVMCRDLEYEIAPDAEPVFFEYIKKRMTMSFFSNARTVRNAVDRARMRAAIRLFNKATDKGSNGMVSKQELMTLEKSDFVSVEELAAR-GDNAIV 390          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: XP_009032594.1 (hypothetical protein AURANDRAFT_19513 [Aureococcus anophagefferens] >EGB12981.1 hypothetical protein AURANDRAFT_19513 [Aureococcus anophagefferens])

HSP 1 Score: 370.5 bits (950), Expect = 6.700e-99
Identity = 182/300 (60.67%), Postives = 225/300 (75.00%), Query Frame = 0
Query:  120 GSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLDLVRNASDDAILA 420
            GS  E+ +  GV+  LDKL+ +L+GL PVK RVRE+A++LV+DKMR+ +G D  +   LHMCFTGAPGTGKTTVA RMG I   MGYCRSGHVV+ATRD LVGQYVGHT PKTKEVIKQA+GG+L +DEAYYLYNA NDRDYG ESIEILL  ME    DLIV+ AGYKDRMD+FFS+IPGM SR+  HIDFP+ E D+L E+ ++M  ++EY +S +A    + Y+  R D  FFSNAR+VRNA+D ARM++A R+++ A AP ++G IT   + EI   DF  +LD    A DDAILA
Sbjct:   11 GSVSEYMFKEGVKDQLDKLDYDLVGLLPVKQRVREIAALLVLDKMRRKLGFDTAV-PSLHMCFTGAPGTGKTTVAVRMGQILAKMGYCRSGHVVVATRDDLVGQYVGHTAPKTKEVIKQALGGVLLVDEAYYLYNAANDRDYGQESIEILLNFMENNREDLIVVLAGYKDRMDKFFSFIPGMNSRIGNHIDFPNYEVDELYEIARVMTRDLEYDMSEEAGDVFKRYIERRMDMPFFSNARTVRNAMDRARMNSAIRIFDEAIAPHSSGDITAAQMKEIAPADFQIILDEALEAPDDAILA 309          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: ABP93410.1 (cbbx protein [Saccharina japonica] >ADG62366.1 CbbX [Saccharina japonica])

HSP 1 Score: 370.5 bits (950), Expect = 6.700e-99
Identity = 205/395 (51.90%), Postives = 263/395 (66.58%), Query Frame = 0
Query:   19 SGFQVPA----PCAPGRRLPVCMAEGEAPSKHG-GLTYNKEKAMAGDINSGNYRKLSDAMIRAEKEAKRNEEXXXXXXMAEELARQARAKKVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIA-TAPGATGVITLDDLTEIKKEDFDGLLD 408
            + FQ+PA          R  + MA+    +  G GL YN +K    + N GNYRKLS+A+  A+ EA+ N E               R KK+  +  +  + +  VG+ +EF +  GV+  LDKL+++L+GL PVK RVR++A++LV+DKMR  +G D  +   LHMCFTGAPGTGKTTVA RMG I + MGYCR GHVV+ATRD LVGQYVGHT PKTKE+IK+A GGIL +DEAYYLYNA ND+DYG ESIEILL VME++  DLIV  AGYKDRMD+FFSYIPGM SRV  HIDFP+   D+LVE+  +M  ++EY +   A    ++Y+  R    FFSNAR+VRNA+D ARM++A RV+  A  A GA G+++  DL  I   DF  LLD
Sbjct:   18 AAFQIPAVTRQVSGASSRTAISMAQPSVGTGQGKGLDYNPDK-FTDEKNKGNYRKLSEALEAADVEARINAEEADKREXXXXXXXXXRLKKIKFMADMDDSIE--VGTVEEFMFKEGVRDILDKLDSDLVGLVPVKLRVRQIAALLVLDKMRGKLGFDTAV-PSLHMCFTGAPGTGKTTVALRMGQILQRMGYCRQGHVVVATRDDLVGQYVGHTAPKTKEMIKKAFGGILLVDEAYYLYNAANDKDYGQESIEILLNVMEEQKEDLIVTLAGYKDRMDRFFSYIPGMSSRVGNHIDFPNYLTDELVEIAIVMARDLEYFMDDSALAVFKQYIEKRMKFPFFSNARTVRNAMDRARMNSAIRVFNDAIIATGAGGMVSEKDLAVITDADFQVLLD 408          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: XP_001713246.1 (CbbX protein homolog [Guillardia theta] >Q9SCC7.1 RecName: Full=Protein cbbX homolog, chloroplastic; Flags: Precursor >CAB65663.1 CbbX protein homologue [Guillardia theta] >CAC27030.1 CbbX protein homolog [Guillardia theta])

HSP 1 Score: 370.2 bits (949), Expect = 8.700e-99
Identity = 182/315 (57.78%), Postives = 241/315 (76.51%), Query Frame = 0
Query:  104 KVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLDLVRNASDDAIL 419
            K+ +LN++    +   G+ +EF +  GV+  L+KL+ +L+GL PVKSRVRE+A++LVVDK+R+++GLD  +   LHMCFTGAPGTGKTTVA RMG I + MGYCRSGH+V+ATRD LVGQYVGHT PKTKEVIK+AMGG+L IDEAYYLYNA NDRDYG ESIEILL VME+   DL+V+ AGYKDRMD+FFS+IPGM SRV  HI+FP+ E ++L+ + K+M  ++EY++S DAEP   EY+  R    +FSNAR+VRNAVD ARM AA R++  AT+  + G+++   L  ++KEDF  + +L+    D+AI+
Sbjct:   60 KIDRLNAIPEDAE--AGTVEEFMYKDGVKEILEKLDNDLVGLVPVKSRVREIAALLVVDKLRRNLGLDTSV-PSLHMCFTGAPGTGKTTVAMRMGQILQRMGYCRSGHLVVATRDDLVGQYVGHTAPKTKEVIKKAMGGVLLIDEAYYLYNASNDRDYGQESIEILLNVMEENREDLVVVLAGYKDRMDKFFSFIPGMSSRVGNHIEFPNYEAEELLSIAKVMCRDLEYEMSKDAEPIFFEYIKKRMTMPYFSNARTVRNAVDRARMRAAIRLFNQATSGNSNGLVSKKQLMTLEKEDFVSVEELIAR-GDNAIV 370          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: XP_005791855.1 (hypothetical protein EMIHUDRAFT_351387 [Emiliania huxleyi CCMP1516] >EOD39426.1 hypothetical protein EMIHUDRAFT_351387 [Emiliania huxleyi CCMP1516])

HSP 1 Score: 369.0 bits (946), Expect = 1.900e-98
Identity = 178/290 (61.38%), Postives = 227/290 (78.28%), Query Frame = 0
Query:  120 GSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDF----DGL 406
            G+ D+F +  GV+  L+KL+ +LIGLKPVK RVRE+AS+LVVDKMR  +GL+  +   LHM FTGAPGTGKTTVA RMG I + MGYCR+GHVV+ATRD LVGQYVGHT PKTKE++K+AMGGIL +DEAYYLYNA NDRDYG ES+EILL VME    D+IV+ AGYKD+MD F+ +IPGM SR+  HI+FPD E ++LVE+GK++   +EYKL P AEPAL++Y++ RK   FF+NAR+VRNA+DLARM +A RV+E   +P + G+++ D+L  I  +DF    DGL
Sbjct:   11 GTVDDFMYKEGVKDILEKLDYDLIGLKPVKQRVREIASLLVVDKMRLKLGLETSV-PSLHMGFTGAPGTGKTTVALRMGQILQRMGYCRTGHVVVATRDDLVGQYVGHTAPKTKEMVKKAMGGILLVDEAYYLYNAANDRDYGQESVEILLNVMENNKEDIIVVLAGYKDKMDAFYGFIPGMASRIGNHIEFPDYEDEELVEIGKVLRRELEYKLGPGAEPALKDYLSKRKRMPFFANARTVRNAIDLARMGSAIRVFEEKMSPSSNGMVSEDELMTIMPDDFPAPEDGL 299          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: XP_003239667.1 (CbbX protein [Cryptomonas paramecium] >AEA38769.1 CbbX protein (nucleomorph) [Cryptomonas paramecium])

HSP 1 Score: 368.6 bits (945), Expect = 2.500e-98
Identity = 182/315 (57.78%), Postives = 238/315 (75.56%), Query Frame = 0
Query:  101 RAKKVAKLNSVMSTP-KQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLDLVRNASD 415
            R +K  +L+ + + P  +  G+ +EF +  GV+  L KL+ +LIGLKPVK +V+E+A++LVVDK+R+++GLD  +   LHMCFTG+PGTGKTTVA RMG I + MGY RSGH+VLATRD LVGQY+GHT PKTKEVIK+AMGG+L IDEAYYLYNA NDRDYG ESIEILL VME+   DL+VI AGYKDRMD+FFSYIPGM SR+  HI+FPD + D+LV + K+M  ++EY++SP+AEP    Y+  R +  FFSNAR+VRNAVD ARM AA R++  AT   + G ++  DL  ++KEDF    +L+  ++D
Sbjct:   26 RLQKKMRLSRLQAIPDDEEAGTVEEFMYKDGVKEILKKLDEDLIGLKPVKDQVKEIAALLVVDKLRRNLGLDTSV-PSLHMCFTGSPGTGKTTVAMRMGQILQRMGYSRSGHLVLATRDDLVGQYIGHTAPKTKEVIKKAMGGVLLIDEAYYLYNASNDRDYGQESIEILLNVMEENREDLVVILAGYKDRMDKFFSYIPGMSSRIGNHIEFPDYKVDELVSIAKIMCRDLEYEMSPEAEPVFYNYIKTRMNMPFFSNARTVRNAVDRARMKAAIRLFNKATDVQSDGFVSKKDLMTLEKEDFVTSDELISLSND 339          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: KOO53179.1 (cbbx protein [Chrysochromulina sp. CCMP291])

HSP 1 Score: 367.9 bits (943), Expect = 4.300e-98
Identity = 188/348 (54.02%), Postives = 246/348 (70.69%), Query Frame = 0
Query:   60 DINSGNYRKLSDAMIRAEKEAKRNEEXXXXXXMAEELARQARAKKVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDFDGLLD 408
            D   GNYR+LSDA+  ++ E +  E+       A    ++AR +K+  L  +  +     G+ D+F +  GV+  L KL+ +LIGL PVK RVRE+AS+LVVDKMR  +GL+  +   LHM FTGAPGTGKTTVA RMG I + MGYCR+GHVV+ATRD LVGQYVGHT PKTKE++K+AMGGIL +DEAYYLYNA NDRDYG ESIEILL VME    D+IV+ AGYKDRMD+F+S+IPGM SR+  HI+FP+ E D+LV++GK+M  ++EY++   A  A REY++ R    FFSNAR+VRNA+DLARM +A R++    +PG+ G +   +L  I   DF  + D
Sbjct:   60 DPAKGNYRRLSDALKTSDLERRLEEDAIAMREDALRRKKEARERKIMLLQKIPDS--MQAGTVDDFMYKEGVKDILQKLDYDLIGLLPVKQRVREIASLLVVDKMRLKLGLETSV-PSLHMGFTGAPGTGKTTVALRMGQILQRMGYCRTGHVVVATRDDLVGQYVGHTAPKTKEMVKKAMGGILLVDEAYYLYNAANDRDYGQESIEILLNVMENNKEDIIVVLAGYKDRMDKFYSFIPGMNSRIGNHIEFPNYELDELVQIGKVMCRDLEYEMDASAIEAFREYMSRRMRMPFFSNARTVRNAIDLARMKSAVRIFNEKMSPGSNGDVQDFELMTITAADFPVITD 404          
BLAST of NO01G02280 vs. NCBI_GenBank
Match: XP_005707216.1 (AAA-type ATPase family protein / ankyrin repeat family protein [Galdieria sulphuraria] >EME30696.1 AAA-type ATPase family protein / ankyrin repeat family protein [Galdieria sulphuraria])

HSP 1 Score: 361.3 bits (926), Expect = 4.000e-96
Identity = 196/366 (53.55%), Postives = 250/366 (68.31%), Query Frame = 0
Query:   41 EAPSKHGGLT---YNKEKAMAGDINSGNYRKLSDAMIRAEKEAKRNEEXXXXXXMAEELARQARAKKVAKLNSVMSTPKQT-VGSADEFSWDGGVQGALDKLETELIGLKPVKSRVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDIFKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAYYLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPGMQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRKDKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKEDF 403
            ++P KH  LT    + + A+ GD + G  R+LSDA+   + E      XXXXXX                L  +   P +T  G+ DE+ +  GV   LD L+ +LIGL PVK RVRE+A++LV+DK+R  IGLD  +   LHMCFTG+PGTGKTTVA RMG I K MGYCR GH+V+ATRD LVGQYVGHT PKTKEVIK+AMGG+L IDEAYYLYNA N++DYGVESIEILL +ME    DL+V+ AGY+D+M++FFSYIPGM+SR+  HI FPD E D+LVE+ KLM   + Y + PDAE  L+EY+  R    +FSNAR+VRNAVD ARM AA R++    A  + G+++  +L  +K EDF
Sbjct:   40 QSPKKHCALTLLAQSDDGAVGGDASRGYTRRLSDALRERDIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKEI---PDETQAGTVDEYMYKEGVSEVLDSLDVDLIGLLPVKRRVREIAALLVIDKLRAKIGLDTAV-PSLHMCFTGSPGTGKTTVAMRMGQILKKMGYCRQGHLVVATRDDLVGQYVGHTAPKTKEVIKKAMGGVLLIDEAYYLYNAANEKDYGVESIEILLNIMENNKDDLVVVLAGYEDKMNKFFSYIPGMKSRIGNHITFPDYEVDELVEIAKLMCKGLFYDIEPDAEVVLKEYLRKRMAMPYFSNARTVRNAVDRARMRAAVRIFNEKIASSSDGLVSRRELRILKPEDF 401          
The following BLAST results are available for this feature:
BLAST of NO01G02280 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes)
Total hits: 20
Match NameE-valueIdentityDescription
EWM29164.19.700e-20788.07rubisco expression protein [Nannochloropsis gadita... [more]
AFP65258.14.600e-10052.66CbbX protein (nucleomorph) [Chroomonas mesostigmat... [more]
ABD51943.12.300e-9954.47CbbX protein, partial (nucleomorph) [Rhodomonas sa... [more]
XP_009032594.16.700e-9960.67hypothetical protein AURANDRAFT_19513 [Aureococcus... [more]
ABP93410.16.700e-9951.90cbbx protein [Saccharina japonica] >ADG62366.1 Cbb... [more]
XP_001713246.18.700e-9957.78CbbX protein homolog [Guillardia theta] >Q9SCC7.1 ... [more]
XP_005791855.11.900e-9861.38hypothetical protein EMIHUDRAFT_351387 [Emiliania ... [more]
XP_003239667.12.500e-9857.78CbbX protein [Cryptomonas paramecium] >AEA38769.1 ... [more]
KOO53179.14.300e-9854.02cbbx protein [Chrysochromulina sp. CCMP291][more]
XP_005707216.14.000e-9653.55AAA-type ATPase family protein / ankyrin repeat fa... [more]

Pages

back to top
Relationships

This gene is member of the following syntenic_region feature(s):

Feature NameUnique NameSpeciesType
nonsL006nonsL006Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ncniR047ncniR047Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ngnoR091ngnoR091Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region


This gene is orthologous to the following gene feature(s):

Feature NameUnique NameSpeciesType
NSK008107NSK008107Nannochloropsis salina (N. salina CCMP1776)gene


The following polypeptide feature(s) derives from this gene:

Feature NameUnique NameSpeciesType
NO01G02280.1NO01G02280.1-proteinNannochloropsis oceanica (N. oceanica IMET1)polypeptide


The following gene feature(s) are orthologous to this gene:

Feature NameUnique NameSpeciesType
jgi.p|Nanoce1779_2|624747gene_216Nannochloropsis oceanica (N. oceanica CCMP1779)gene
cbbXgene1463Nannochloropsis gaditana (N. gaditana B-31)gene


The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
NO01G02280.1NO01G02280.1Nannochloropsis oceanica (N. oceanica IMET1)mRNA


Sequences
This is aN test div element
The following sequences are available for this feature:

gene sequence

>NO01G02280 ID=NO01G02280|Name=NO01G02280|organism=Nannochloropsis oceanica|type=gene|length=1923bp
AGTTTTAACACGCAAACGACAACTCCGCAATGGTGGTGACAGCATGGAAG
GCGACTCTTATTGGGAGCTGTCTCTTCTTGGCCAGTGGCTTCCAGgtatg
gcggagggatggtgaaatgttttgtgtttgcaaattcatcatgacggggg
gggccaagtgtgcttgctttcatgtggccacggacctatgtcgtgatcat
gcacatgcactgggtcccaggcttattgagagaagtcatctgtctgtcta
gttatgcttcgacgtgaccctttatgtacacccgccgtcgcatggaccac
tgcttttttgctagcttattttctcgccctttgcctcactcccacgaaaa
gGTGCCTGCGCCCTGCGCTCCGGGCCGTCGCCTGCCAGTGTGCATGGCGG
AGGGAGAGGCGCCCTCCAAGCACGGTGGCCTGACGTACAACAAGGAGAAG
GCCATGGCGGGGGACATCAACTCGGGCAACTACCGCAAGCTGAGTGATGC
CATGATCCGCGCAGAGAAGGAGGCCAAGCGCAACGAGGAAGAGAAAAAGC
AGCGAGAAATGGCTGAGGAACTCGCACGCCAGGCCCGAGCCAAGAAGGTG
GCGAAGTTGAACTCCGTCATGTCCACGCCCAAGCAGACTGTGGGCTCTGC
GGACGAGTTCAGCTGGGATGGCGGCGTGCAGGGTGCGCTTGACAAGCTGG
AGACAGAGCTGATTGGTTTGAAGCCTGTCAAGTCCCGTGTGCGGGAGCTG
GCCAGTATGTTGGTGGTGGACAAGATGCGACAGTCTATCGGGCTTGACCC
CTTCATCTCCGACGGCCTGCACATGTGCTTCACCGGTGCACCCGGCACAG
GAAAGACGACGGTGGCATTCCGCATGGGTGATATCTTCAAGGCAATGGGC
TACTGTCGGTCGGGACACGTGGTGCTGGCCACGCGCGACACGCTGGTAGG
CCAGTATGTCGGGCACACGGGCCCCAAGACAAAGGAGGTGATCAAGCAGG
CGATGGGCGGCATCCTGTTTATTGATGAGGCCTACTATCTGTACAACGCT
GGCAACGACCGGGACTACGGCGTAGAGTCCATCGAGATCCTACTTAAGGT
CATGGAGCAGCGCTCGTCCGACCTTATCGTCATCTTCGCCGGCTATAAGG
ACCGCATGGACCAATTCTTTTCCTACATCCCGGGCATGCAGTCACGTGTA
AACCTGCATATTGACTTTCCCGACATGGAACCCGACGATTTGGTGGAGGT
GGGGAAGCTCATGTTCAATAACATGGAGTACAAGCTTTCTCCTGATGCTG
AGCCTGCTTTGCGTGAGTATGTAACGCTGCGCAAGGACAAACTCTTCTTT
TCCAACGCCCGCTCAGTCCGTAATGCCGTGGACTTAGCGCGCATGTCGGC
AGCAAACCGCGTGTACGAGATCGCGACGGCGCCAGGGGCGACTGGGGTCA
TCACCCTTGATGACCTGACGGAGATCAAGAAGGAGGACTTCGATGGCTTG
TTAGATCTGGTCAGGAACGCCTCAGACGATGCTATCCTTGCCTAAGAGAT
GAAGAAAGTGGGAGCACAATCCTTGGGTTGCATGCGTGTGTCGGAGTGGC
CATCACCCCGCCGTCCCTTCAGAAATTAAAGCCTGTATAGGTTGCGCTAT
GTTTCCCCTTTCGGTTCTGGCATCATAGCCAATCTGAGAAAACTTCATTC
GTCAGGATCGTGGTCAGGGAGAGATCTCAGGAGCAAGAGATAATGAGGCA
CGAATTTGTGAAATCCGTACGTTCATCTTATTAAATCCTGTTTTGTGCTG
TTTGAGTGGTTAAAGCTCTTATGAGTATAGTTGTACGCATTGTAAGCGGG
GGGAAGAAAGAGAAGGAAAATGATATCGCAGACAGATGAGAATGTGGCCA
CTGCAAAAGAATCACATGCGATG
back to top

protein sequence of NO01G02280.1

>NO01G02280.1-protein ID=NO01G02280.1-protein|Name=NO01G02280.1|organism=Nannochloropsis oceanica|type=polypeptide|length=420bp
MVVTAWKATLIGSCLFLASGFQVPAPCAPGRRLPVCMAEGEAPSKHGGLT
YNKEKAMAGDINSGNYRKLSDAMIRAEKEAKRNEEEKKQREMAEELARQA
RAKKVAKLNSVMSTPKQTVGSADEFSWDGGVQGALDKLETELIGLKPVKS
RVRELASMLVVDKMRQSIGLDPFISDGLHMCFTGAPGTGKTTVAFRMGDI
FKAMGYCRSGHVVLATRDTLVGQYVGHTGPKTKEVIKQAMGGILFIDEAY
YLYNAGNDRDYGVESIEILLKVMEQRSSDLIVIFAGYKDRMDQFFSYIPG
MQSRVNLHIDFPDMEPDDLVEVGKLMFNNMEYKLSPDAEPALREYVTLRK
DKLFFSNARSVRNAVDLARMSAANRVYEIATAPGATGVITLDDLTEIKKE
DFDGLLDLVRNASDDAILA*
back to top
Synonyms
Publications
YearPublication
2017Li Wei, Qintao Wang, Yi Xin, Yandu Lu, Jian Xu. Enhancing photosynthetic biomass productivity of industrial oleaginous microalgae by overexpression of RuBisCO activase. Algal Research, 2017; 27:366-375.