NO19G02330.1, NO19G02330.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO19G02330.1 vs.
Match: XP_008896317.1 (hypothetical protein PPTG_04205 [Phytophthora parasitica INRA-310]; ETI35982.1 hypothetical protein F443_17808 [Phytophthora parasitica P1569]; ETK76217.1 hypothetical protein L915_17337 [Phytophthora parasitica]; ETL29655.1 hypothetical protein L916_17230 [Phytophthora parasitica]; ETL82877.1 hypothetical protein L917_17063 [Phytophthora parasitica]; ETM36110.1 hypothetical protein L914_17133 [Phytophthora parasitica]; ETN18680.1 hypothetical protein PPTG_04205 [Phytophthora parasitica INRA-310]; ETO64701.1 hypothetical protein F444_17845 [Phytophthora parasitica P1976]; ETP05800.1 hypothetical protein F441_17685 [Phytophthora parasitica CJ01A1]; ETP33910.1 hypothetical protein F442_17665 [Phytophthora parasitica P10297]; KUF76127.1 hypothetical protein AM587_10014974 [Phytophthora nicotianae]; KUF99314.1 hypothetical protein AM588_10009521 [Phytophthora nicotianae]) HSP 1 Score: 119.4 bits (298), Expect = 1.200e-23 Identity = 60/149 (40.27%), Postives = 92/149 (61.74%), Query Frame = 0 Query: 34 SALHESIKRKGINSYYYAHSKQNHAP--DWDGREAPRLMSKQAL-EVGVGREPESIRSYAWSDENEKIKIYVTMEGADALGDEAITLEWNELSLILTVQFPDSKTHLFLIKRLYDEIDDASFRVKKDKIILNLKKKEGKTAAWFDLKKD 180 SALH +IK KG NSYYYAH K+ + +WDG+ APRL+ Q+L E E+I +YAW+D N+++ +Y+ + G A +E ++W SL + ++ + KT L ++ +LYDEI D + K+D+++L L K K +W LKKD Sbjct: 16 SALHSNIKTKGTNSYYYAHKKRENVEIHEWDGKAAPRLLKTQSLAEAQPAEVTEAITNYAWADGNKRVSLYLKLPGIGAHKEEDTLIDWTATSLTVKIKNYEGKTRLLVMSKLYDEISDIKTKRKEDQLVLQLVK--AKEFSWHSLKKD 162 The following BLAST results are available for this feature:
BLAST of NO19G02330.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO19G02330.1 ID=NO19G02330.1|Name=NO19G02330.1|organism=Nannochloropsis oceanica|type=mRNA|length=543bpback to top protein sequence of NO19G02330.1 >NO19G02330.1-protein ID=NO19G02330.1-protein|Name=NO19G02330.1|organism=Nannochloropsis oceanica|type=polypeptide|length=181bpback to top mRNA from alignment at chr19:669271..670422- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO19G02330.1 ID=NO19G02330.1|Name=NO19G02330.1|organism=Nannochloropsis oceanica|type=mRNA|length=1152bp|location=Sequence derived from alignment at chr19:669271..670422- (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr19:669271..670422- >NO19G02330.1 ID=NO19G02330.1|Name=NO19G02330.1|organism=Nannochloropsis oceanica|type=CDS|length=543bp|location=Sequence derived from alignment at chr19:669271..670422- (Nannochloropsis oceanica)back to top Synonyms
Publications
|