NO28G00190.1, NO28G00190.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO28G00190.1 vs.
Match: CBN74156.1 (similar to ubiquitin and ribosomal protein S27a precursor [Ectocarpus siliculosus]) HSP 1 Score: 98.2 bits (243), Expect = 2.500e-17 Identity = 54/100 (54.00%), Postives = 75/100 (75.00%), Query Frame = 0 Query: 65 MQLFIQS-NGSTFTLNVAEGATVHELKAAVEDKEFIPSSLQRLVTGTTTLTDGLLSEFGVEEESTIQLLMDINGGMRAKWRKKRMRRLRRKRRKMRMRAR 164 MQ+F+++ G++ L V+ ++ +KAAVE +EF+P++L RL G L+ G L++ G+EE T+ LL+D+ GGMRAKWRKKRMRRLRRKRRKMR RAR Sbjct: 1 MQIFVKTLGGASLPLEVSPATSITAVKAAVEAQEFLPAALMRLNHGNAQLSSGCLADAGIEEADTLTLLLDVRGGMRAKWRKKRMRRLRRKRRKMRQRAR 100 The following BLAST results are available for this feature:
BLAST of NO28G00190.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO28G00190.1 ID=NO28G00190.1|Name=NO28G00190.1|organism=Nannochloropsis oceanica|type=mRNA|length=492bpback to top protein sequence of NO28G00190.1 >NO28G00190.1-protein ID=NO28G00190.1-protein|Name=NO28G00190.1|organism=Nannochloropsis oceanica|type=polypeptide|length=164bpback to top mRNA from alignment at chr28:76556..78582- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO28G00190.1 ID=NO28G00190.1|Name=NO28G00190.1|organism=Nannochloropsis oceanica|type=mRNA|length=2027bp|location=Sequence derived from alignment at chr28:76556..78582- (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr28:76556..78582- >NO28G00190.1 ID=NO28G00190.1|Name=NO28G00190.1|organism=Nannochloropsis oceanica|type=CDS|length=492bp|location=Sequence derived from alignment at chr28:76556..78582- (Nannochloropsis oceanica)back to top Synonyms
Publications
|