NO15G02460.1, NO15G02460.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO15G02460.1 vs.
Match: XP_005852758.1 (large subunit ribosomal protein L22e [Nannochloropsis gaditana CCMP526]; EKU23074.1 large subunit ribosomal protein L22e [Nannochloropsis gaditana CCMP526]; EWM22321.1 ribosomal protein l22 [Nannochloropsis gaditana]) HSP 1 Score: 208.4 bits (529), Expect = 1.300e-50 Identity = 102/125 (81.60%), Postives = 114/125 (91.20%), Query Frame = 0 Query: 1 MAPTKVGAKGKKGGKKNLVKYTIDCNQPVDDKVLDMGTFEKFLKDRIKVNGKAGVLGDSVTVGRDKSKIQVTAELPFSKRYLKYLTKKHLKKQQLRDYLHVVATNKQTYELKYFSVQDEGGDDDE 126 MAPTK+GAKG+KG KKN VK+TIDC+ PV D VLDM FEKFLKDRIKVNGKAGVLGD+V V R+KSKIQVTAELPFSKRYLKYLTKKHLKKQQLRDY+ VVATNKQT+ELKY++V DEGG+D+E Sbjct: 1 MAPTKLGAKGRKGSKKNQVKFTIDCSDPVKDGVLDMANFEKFLKDRIKVNGKAGVLGDAVAVAREKSKIQVTAELPFSKRYLKYLTKKHLKKQQLRDYMRVVATNKQTFELKYYTVTDEGGEDEE 125 The following BLAST results are available for this feature:
BLAST of NO15G02460.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO15G02460.1 ID=NO15G02460.1|Name=NO15G02460.1|organism=Nannochloropsis oceanica|type=mRNA|length=876bpback to top protein sequence of NO15G02460.1 >NO15G02460.1-protein ID=NO15G02460.1-protein|Name=NO15G02460.1|organism=Nannochloropsis oceanica|type=polypeptide|length=126bpback to top mRNA from alignment at chr15:674855..676381+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO15G02460.1 ID=NO15G02460.1|Name=NO15G02460.1|organism=Nannochloropsis oceanica|type=mRNA|length=1527bp|location=Sequence derived from alignment at chr15:674855..676381+ (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr15:674855..676381+ >NO15G02460.1 ID=NO15G02460.1|Name=NO15G02460.1|organism=Nannochloropsis oceanica|type=CDS|length=378bp|location=Sequence derived from alignment at chr15:674855..676381+ (Nannochloropsis oceanica)back to top Synonyms
Publications
|