NO12G00040.2, NO12G00040.2 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO12G00040.2 vs.
Match: XP_005854314.1 (hypothetical protein NGA_0190800 [Nannochloropsis gaditana CCMP526]; EKU22053.1 hypothetical protein NGA_0190800 [Nannochloropsis gaditana CCMP526]; EWM26009.1 hypothetical protein Naga_100150g3 [Nannochloropsis gaditana]) HSP 1 Score: 126.3 bits (316), Expect = 9.000e-26 Identity = 65/115 (56.52%), Postives = 80/115 (69.57%), Query Frame = 0 Query: 58 KVTTGVATFFTGFQLLFRTDYGEREHVFTPIQRWYTDQVDALLGVESEIARRLKTPTLSLAPSQEGEERARVASVAAAAAAAVTDPPLPPVGDGEG-EAGRQEGVKGWKKFIKWW 172 KV TGV TGFQL+F TDYG++EHVFTPIQRWY Q+D+LLGVESE+ARRL+TPT SL S+E EE AR A+ A ++ P P GEG GR+ G GW+++I WW Sbjct: 17 KVATGVICLVTGFQLVFLTDYGDKEHVFTPIQRWYMGQLDSLLGVESEVARRLRTPTFSLNSSKEAEESARAATAAPQPDVNLSHSPSMPAKAGEGVREGRESG--GWRRWISWW 129 The following BLAST results are available for this feature:
BLAST of NO12G00040.2 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO12G00040.2 ID=NO12G00040.2|Name=NO12G00040.2|organism=Nannochloropsis oceanica|type=mRNA|length=1055bpback to top protein sequence of NO12G00040.2 >NO12G00040.2-protein ID=NO12G00040.2-protein|Name=NO12G00040.2|organism=Nannochloropsis oceanica|type=polypeptide|length=172bpback to top mRNA from alignment at chr12:8004..9289+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO12G00040.2 ID=NO12G00040.2|Name=NO12G00040.2|organism=Nannochloropsis oceanica|type=mRNA|length=1286bp|location=Sequence derived from alignment at chr12:8004..9289+ (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr12:8004..9289+ >NO12G00040.2 ID=NO12G00040.2|Name=NO12G00040.2|organism=Nannochloropsis oceanica|type=CDS|length=516bp|location=Sequence derived from alignment at chr12:8004..9289+ (Nannochloropsis oceanica)back to top Synonyms
Publications
|