NO06G04740.1, NO06G04740.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO06G04740.1 vs.
Match: XP_024636396.1 (uncharacterized protein LOC112420871 [Medicago truncatula]) HSP 1 Score: 82.8 bits (203), Expect = 6.800e-13 Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 0 Query: 8 NSDPIPPSADRLSQDENEGAYPTALLNSKNPPSFALHQLRLKVGIPIILLRNADPVQGLANGTRLLILHLSPRVIEAKILTGIHVG 94 +SD I + D +S + E YP LNS N F H L LK G+PI+LLRN +P G+ NGTRL+I HL RVIEAKI+TG +VG Sbjct: 1242 SSDEIDKTTDNIS--DQELMYPVEFLNSLNINGFPRHCLELKEGMPIMLLRNINPALGMCNGTRLIITHLGERVIEAKIITGSNVG 1325 The following BLAST results are available for this feature:
BLAST of NO06G04740.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO06G04740.1 ID=NO06G04740.1|Name=NO06G04740.1|organism=Nannochloropsis oceanica|type=mRNA|length=306bpback to top protein sequence of NO06G04740.1 >NO06G04740.1-protein ID=NO06G04740.1-protein|Name=NO06G04740.1|organism=Nannochloropsis oceanica|type=polypeptide|length=102bpback to top mRNA from alignment at chr6:1354077..1354382- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO06G04740.1 ID=NO06G04740.1|Name=NO06G04740.1|organism=Nannochloropsis oceanica|type=mRNA|length=306bp|location=Sequence derived from alignment at chr6:1354077..1354382- (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr6:1354077..1354382- >NO06G04740.1 ID=NO06G04740.1|Name=NO06G04740.1|organism=Nannochloropsis oceanica|type=CDS|length=306bp|location=Sequence derived from alignment at chr6:1354077..1354382- (Nannochloropsis oceanica)back to top Synonyms
Publications
|